Tested Applications
| Positive WB detected in | HEK-293 cells, COLO 320 cells, mouse brain tissue, HepG2 cells, mouse lung tissue, human lung tissue, HeLa cells, K-562 cells |
| Positive IHC detected in | human pancreas cancer tissue, human lung cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12580-1-AP targets EDIL3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3274 Product name: Recombinant human EDIL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 131-480 aa of BC030828 Sequence: GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE Predict reactive species |
| Full Name | EGF-like repeats and discoidin I-like domains 3 |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52-55 kDa |
| GenBank Accession Number | BC030828 |
| Gene Symbol | EDIL3 |
| Gene ID (NCBI) | 10085 |
| RRID | AB_2096219 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43854 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EGF-like repeats and discoidin I-like domain-containing protein 3 (EDIL3), also named as DEL1 or integrin-biding protein DEL1, is a 52-kDa extracellular matrix protein produced by endothelial cells in embryos (PMID: 9420328). It is composed of three EGF repeats and two discoidin I-like domains. The second EGF repeat contains an RGD motif. EDIL3 promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. It may be involved in vascular remodeling during angiogenesis (PMID: 12840057; 14981004). EDIL3 has also been reported to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion (PMID: 19008446).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EDIL3 antibody 12580-1-AP | Download protocol |
| WB protocol for EDIL3 antibody 12580-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EDIL3 Polyclonal antibody (Cat# 12580-1-AP) has 25 citations spanning journals including Nature Communications, Journal of Clinical Investigation, Molecular Cancer, Oncotarget, Journal of Biological Chemistry, Stem Cell Reports, and others. Research fields covered include oncology (hepatocellular, pancreatic, and oral cancers), inflammation, fibrosis, angiogenesis, bone biology, sepsis, atherosclerosis, preeclampsia, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Mol Cancer Elevated autocrine EDIL3 protects hepatocellular carcinoma from anoikis through RGD-mediated integrin activation. | ||
Nat Commun Defective O-fucosylation of EDIL3 attenuates invasion and vascular remodeling of trophoblasts via LIFR signaling pathway in preeclampsia. | ||
Nat Commun Antagonistic effects of IL-17 and D-resolvins on endothelial Del-1 expression through a GSK-3β-C/EBPβ pathway. | ||
J Clin Invest Secreted protein Del-1 regulates myelopoiesis in the hematopoietic stem cell niche.
| ||
Cell Death Discov Newly identified invasion drivers define the tumor front in oral squamous cell carcinoma. | ||
Reviews
What customers say
The single review for this product reports a 5-star rating from a Western Blot experiment performed on ARPE-19 cells at a 1:500 dilution. The reviewer noted that the antibody produced a clear and specific band, indicating strong performance and specificity in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Guo-rong (Verified Customer) (08-30-2022) | It gives a clear and specific band
 |
