EDIL3 Recombinant monoclonal antibody, PBS Only

EDIL3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 86715-1-PBS
Clone No.251179F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

DEL1, Developmentally-regulated endothelial cell locus 1 protein, EGF-like repeat and discoidin I-like domain-containing protein 3, Integrin-binding protein DEL1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86715-1-PBS targets EDIL3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3274

Product name: Recombinant human EDIL3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 131-480 aa of BC030828

Sequence: GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Predict reactive species
Full Name EGF-like repeats and discoidin I-like domains 3
Calculated Molecular Weight 52 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC030828
Gene Symbol EDIL3
Gene ID (NCBI) 10085
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43854
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EGF-like repeats and discoidin I-like domain-containing protein 3 (EDIL3), also named as DEL1 or integrin-biding protein DEL1, is a 52-kDa extracellular matrix protein produced by endothelial cells in embryos (PMID: 9420328). It is composed of three EGF repeats and two discoidin I-like domains. The second EGF repeat contains an RGD motif. EDIL3 promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. It may be involved in vascular remodeling during angiogenesis (PMID: 12840057; 14981004). EDIL3 has also been reported to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion (PMID: 19008446).

Loading...
||
New chat

Able

正在加载,请稍候...