• Featured Product
  • KD/KO Validated

EEF1B2 Monoclonal antibody

EEF1B2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 60329-1-Ig
Clone No.3E1C11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

3E1C11, EEF1B, EEF1B1, EF 1 beta, EF1B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, rabbit brain tissue, HepG2 cells, Jurkat cells, pig brain tissue, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60329-1-Ig targets EEF1B2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0135

Product name: Recombinant human EEF1B2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-223 aa of BC000211

Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFN

Predict reactive species
Full Name eukaryotic translation elongation factor 1 beta 2
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC000211
Gene Symbol EEF1B2
Gene ID (NCBI) 1933
RRIDAB_2881438
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP24534
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In eukaryotes, the translation elongation factor eEF1A responsible for transporting amino-acylated tRNA to the ribosome forms a higher-order complex, eEF1H, with its guanine-nucleotide-exchange factor eEF1B. eEF1B consists of three subunits: eEF1B alpha, eEF1B beta and eEF1B gamma. The eEF1B2 possess the nucleotide-exchange activity. Although several models on the basis of in vitro experiments have been proposed for the macromolecular organization of the eEF1H complex, these models differ in various aspects. The human eukaryote elongation factor 1 beta 2 (eEF1B2) migrated as a 30-34 kDa protein in SDS-PAGE.

Protocols

Product Specific Protocols
IF protocol for EEF1B2 antibody 60329-1-IgDownload protocol
IHC protocol for EEF1B2 antibody 60329-1-IgDownload protocol
WB protocol for EEF1B2 antibody 60329-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...