EFHC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EFHC1 Polyclonal antibody (11471-1-AP)

EFHC1 Polyclonal Antibody for WB, ELISA

Cat No. 11471-1-AP Copied!

Publications (1)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EFHC1, EJM, EJM1, JAE, Myoclonin 1

• 

  WB analysis using 11471-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11471-1-AP (EFHC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EFHC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11471-1-AP targets EFHC1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2048

  Product name: Recombinant human EFHC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-640 aa of BC020210

  Sequence: LMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELLRMCSHGEGKINYYNFVRAFSN

• Full Name: EF-hand domain (C-terminal) containing 1
• Calculated Molecular Weight: 640 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC020210
• Gene Symbol: EFHC1
• Gene ID (NCBI): 114327
• RRID: AB_2877766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JVL4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EFHC1 Polyclonal antibody (Cat# 11471-1-AP) has 1 citation. It was used in a Western blot study published in the Journal of the American Heart Assoc (2023), investigating cardiac myocyte-specific overexpression of FASTKD1 and its role in preventing ventricular rupture after myocardial infarction in mice. The research falls within the fields of cardiology and cardiac myocyte biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Mouse	WB	J Am Heart Assoc; Cardiac Myocyte-Specific Overexpression of FASTKD1 Prevents Ventricular Rupture After Myocardial Infarction; Authors - Kurt D Marshall

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this product (rated 4/5) reports successful use in Western Blot at a 1:1000 dilution on spinal cord tissue. The reviewer noted the presence of some unspecific bands but stated that overall the antibody works well for revealing VGAT (57 kDa) bands.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Marc (Verified Customer) (03-02-2022)

There are some unspecific bands, but overall works pretty well to to reveal VGAT (57KDa) bands.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Spinal Cord