EGFL7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EGFL7 Polyclonal antibody, PBS Only (26661-1-PBS)

• 

  WB analysis using 26661-1-AP (same clone as 26661-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26661-1-AP (EGFL7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 26661-1-AP (same clone as 26661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26661-1-AP (EGFL7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26661-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 26661-1-AP (same clone as 26661-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26661-1-AP (EGFL7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26661-1-PBS in a different storage buffer formulation.

EGFL7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26661-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EGF like domain, multiple 7, EGF like protein 7, EGF-like protein 7, Epidermal growth factor-like protein 7, MEGF7

---

Product Information

26661-1-PBS targets EGFL7 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24693

  Product name: Recombinant human EGFL7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 141-273 aa of BC012377

  Sequence: CSARRGGCPQRCINTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

• Full Name: EGF-like-domain, multiple 7
• Calculated Molecular Weight: 273 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012377
• Gene Symbol: EGFL7
• Gene ID (NCBI): 51162
• RRID: AB_3669560
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHF1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Epidermal growth factor-like protein 7 (EGFL7, also known as MEGF7, ZNEU1, and VE-STATIN) is a proangiogenic factor that has been widely described as having a vital role in tubulogenesis and regulation of angiogenesis, mainly during embryogenesis organogenesis (PMID: 22160377; 15162510). It also can reduce central nervous system inflammation and may play a role in tumorigenesis (PMID: 29483510; 37490307).