EGLN3 Recombinant monoclonal antibody

• 

  WB analysis using 82377-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82377-1-RR (EGLN3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 82377-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EGLN3/PHD3 antibody (82377-1-RR, Clone: 1O19 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of U2OS using 82377-1-RR

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using EGLN3/PHD3 antibody (82377-1-RR, Clone: 1O19 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of U2OS using 82377-1-RR

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug EGLN3/PHD3 Recombinant antibody (82377-1-RR, Clone:1O19) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

EGLN3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 82377-1-RR

Clone No.1O19

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

EGLN3/PHD3, PHD3, 1O19, EC:1.14.11.-, EC:1.14.11.29

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse kidney tissue, rat kidney tissue
• Positive IF/ICC detected in: HepG2 cells, U2OS cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82377-1-RR targets EGLN3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13197

  Product name: Recombinant human EGLN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-239 aa of BC010992

  Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED

• Full Name: egl nine homolog 3 (C. elegans)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC010992
• Gene Symbol: EGLN3
• Gene ID (NCBI): 112399
• RRID: AB_3670522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H6Z9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.