EGR3 Polyclonal antibody

• 

  WB analysis using 26495-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26495-1-AP (EGR3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

EGR3 Polyclonal Antibody for WB, ELISA

Cat No. 26495-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

early growth response 3, Early growth response protein 3, EGR 3, PILOT

---

Tested Applications

• Positive WB detected in: L02 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26495-1-AP targets EGR3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24152

  Product name: Recombinant human EGR3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-186 aa of BC104765

  Sequence: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSN

• Full Name: early growth response 3
• Calculated Molecular Weight: 387 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC104765
• Gene Symbol: EGR3
• Gene ID (NCBI): 1960
• RRID: AB_3669540
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06889
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The early growth response (Egr) family of zinc finger transcription factors regulates critical genetic programs in cellular growth, differentiation, and function. EGR3 (Early Growth Response 3; also known as PILOT) is a member of the early growth response (Egr) gene family of transcription factors. EGR3 regulates the expression of genes involved in inflammation, including genes encoding various secreted cytokines and protease inhibitors. EGR3 functions as a master regulator of genes differentially expressed in the brains of patients with neuropsychiatric illnesses ranging from schizophrenia and bipolar disorder to Alzheimer's disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,rat	WB	Free Radic Biol Med; Transcription factor EGR2 drives cataract formation through IGFBP3-mediated oxidative injury in lens epithelial cells.; Authors - Wanqian Li