EGR4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EGR4 Polyclonal antibody (27682-1-AP)

• 

  WB analysis using 27682-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27682-1-AP (EGR4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

EGR4 Polyclonal Antibody for WB, ELISA

Cat No. 27682-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

early growth response 4, Early growth response protein 4, EGR4 protein, NGFI C, NGFIC

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-231 cells, PC-12 cells, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27682-1-AP targets EGR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26687

  Product name: Recombinant human EGR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-140 aa of NM_001965

  Sequence: MPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA

• Full Name: early growth response 4
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62-70 kDa
• GenBank Accession Number: NM_001965
• Gene Symbol: EGR4
• Gene ID (NCBI): 1961
• RRID: AB_3742247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05215
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGR4 is a member of the Early Growth Response (EGR) family of transcription factors, which also includes EGR1, EGR2, and EGR3. These proteins are characterized by their rapid and transient induction in response to a wide array of extracellular signals. EGR4 functions as a sequence-specific DNA-binding protein that regulates the expression of target genes involved in critical biological processes, most notably in the nervous and immune systems.