Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, MDA-MB-231 cells, PC-12 cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27682-1-AP targets EGR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26687 Product name: Recombinant human EGR4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 28-140 aa of NM_001965 Sequence: MPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA Predict reactive species |
| Full Name | early growth response 4 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62-70 kDa |
| GenBank Accession Number | NM_001965 |
| Gene Symbol | EGR4 |
| Gene ID (NCBI) | 1961 |
| RRID | AB_3742247 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05215 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EGR4 is a member of the Early Growth Response (EGR) family of transcription factors, which also includes EGR1, EGR2, and EGR3. These proteins are characterized by their rapid and transient induction in response to a wide array of extracellular signals. EGR4 functions as a sequence-specific DNA-binding protein that regulates the expression of target genes involved in critical biological processes, most notably in the nervous and immune systems.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EGR4 antibody 27682-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

