EHF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EHF Polyclonal antibody (27195-1-AP)

• Featured Product
• KD/KO Validated

EHF Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27195-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ChIP, ELISA

Synonyms

Epithelium-specific Ets transcription factor 3, ESE 3, ESE3, ESE-3, ESE3B

• 

  WB analysis of LNCaP using 27195-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 27195-1-AP (EHF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 27195-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27195-1-AP (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 27195-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27195-1-AP (EHF antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EHF in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells, A431 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27195-1-AP targets EHF in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25885

  Product name: Recombinant human EHF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC038995

  Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHT

• Full Name: ets homologous factor
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC038995
• Gene Symbol: EHF
• Gene ID (NCBI): 26298
• RRID: AB_2880796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZC4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ETS homologous factor (EHF) is also named Epithelium-specific Ets transcription factor 3 (ESE-3), ESE3B and ESEJ. EHF is a member of the E26 transformation-specific (ETS) gene superfamily (PMID: 12894586). EHF as a tumour suppressor in PDAC. In PDAC, EHF promotes E-cadherin expression and suppresses epithelial-mesenchymal transition (PMID: 27923832). EHF deficiency induces the conversion and expansion of Treg cells and MDSCs by inhibiting TGFβ1 and GM-CSF secretion (PMID: 30733283). In prostate cancer, EHF plays a vital role in the inhibition of cell-intrinsic CSCs signal by suppressing STAT3 and repressing the expression of TWIST1, ZEB2, BMI1 and POU5F1 (PMID: 27732936, PMID: 22505649). EHF not only plays a cell autonomous role in regulating CSC stemness but also has important functions in regulating the sensitivity to a pro-CSC stimulus from the PSC niche (PMID: 33674341).

Publications

What published studies show

The antibody is an EHF (ETS Homologous Factor) antibody, catalog number 27195-1-AP, with a total of 10 citations. These appear in journals including Cell Biosciences, Oncogenesis, International Journal of Molecular Sciences, Journal of Clinical Endocrinology & Metabolism, BMC Cancer, Regenerative Therapy, Endocrinology, Journal of Bioenergetics and Biomembranes, American Journal of Cancer Research, and Gene. Research fields span oncology (gastric, lung, thyroid, endometrial, colon, and renal cancers), ferroptosis, transcriptional regulation, macrophage polarization, and glycolysis.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Biosci; Cholesterol confers resistance to Apatinib-mediated ferroptosis in gastric cancer; Authors - Zhiwei Li
human	WB,ChIP	Oncogenesis; Aberrant super-enhancer landscape reveals core transcriptional regulatory circuitry in lung adenocarcinoma.; Authors - Te Zhang ; KD Validated
human	IHC	Int J Mol Sci; Multiomics Reveals IL-17 Drives Epithelial Keratinization and Proliferation via EHF in Odontogenic Keratocysts.; Authors - Jing-Rui Yi
human	WB,ChIP	J Clin Endocrinol Metab; BRAF-induced EHF expression affects TERT in aggressive papillary thyroid cancer; Authors - Yiyi Xu
human	WB	BMC Cancer; EHF as a key regulator mediating cell migration and may contribute to tumor immune infiltration and progression in human endometrial cancer.; Authors - Xinyi Chen ; KD Validated
human	WB,ChIP	Regen Ther; Lung cancer cell-derived exosomal EHF drives M2 macrophage polarization via transcriptional activation of RNF41 to promote tumor progression.; Authors - Zhongjie Chen ; KD Validated