EHF Polyclonal antibody

• 

  WB analysis of LNCaP using 27195-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 27195-1-AP (EHF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 27195-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27195-1-AP (EHF antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 27195-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27195-1-AP (EHF antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

EHF Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27195-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ChIP, ELISA

Synonyms

ESEJ, ESE3B, ESE-3, ESE3, ESE 3

---

Tested Applications

• Positive WB detected in: LNCaP cells, A431 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• ChIP: See 4 publications below

Product Information

27195-1-AP targets EHF in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25885

  Product name: Recombinant human EHF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC038995

  Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHT

• Full Name: ets homologous factor
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC038995
• Gene Symbol: EHF
• Gene ID (NCBI): 26298
• RRID: AB_2880796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZC4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,ChIP	Oncogenesis; Aberrant super-enhancer landscape reveals core transcriptional regulatory circuitry in lung adenocarcinoma.; Authors - Te Zhang ; KD Validated
human	ChIP	Am J Cancer Res; Ese-3 contributes to colon cancer progression by downregulating EHD2 and transactivating INPP4B.; Authors - Junqiang Li ; KD Validated
human	ChIP	Gene; ETS homologous factor, controlled by lysine-specific demethylase 5B, suppresses clear cell renal cell carcinoma by inducing Filamin-B; Authors - Fang Wang
human	WB,ChIP	J Clin Endocrinol Metab; BRAF-induced EHF expression affects TERT in aggressive papillary thyroid cancer; Authors - Yiyi Xu
human	WB	Endocrinology; NEAT1_2/RRAD/EHF positive feedback loop facilitates aerobic glycolysis in papillary thyroid cancer cells; Authors - Wei Sun