EIF1 Polyclonal antibody

• 

  IP experiment of Jurkat using 15276-1-AP

  IP result of anti-EIF1 (IP:15276-1-AP, 4ug; Detection:15276-1-AP 1:600) with Jurkat cells lysate 3440 ug.

• 

  IHC staining of human prostate cancer using 15276-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 15276-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 15276-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 15276-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15276-1-AP (EIF1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EIF1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15276-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IP, ELISA

Synonyms

A121, EIF 1, EIF1, EIF1A, ISO1, SUI1, Sui1iso1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

15276-1-AP targets EIF1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, monkey, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7394

  Product name: Recombinant human EIF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC005118

  Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

• Full Name: eukaryotic translation initiation factor 1
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC005118
• Gene Symbol: EIF1
• Gene ID (NCBI): 10209
• RRID: AB_2878121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41567
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	J Hematol Oncol; METTL16 promotes liver cancer stem cell self-renewal via controlling ribosome biogenesis and mRNA translation; Authors - Meilin Xue
human	IHC	Front Immunol; A novel cuproptosis pattern and tumor immune microenvironment characterization in urothelial carcinoma of the bladder; Authors - Huan Feng
	WB	PLoS Pathog; SARS-CoV-2 Nsp1 cooperates with initiation factors EIF1 and 1A to selectively enhance translation of viral RNA; Authors - Ranen Aviner
monkey	WB	bioRxiv; SARS-CoV-2 Nsp1 regulates translation start site fidelity to promote infection; Authors - Ranen Aviner
hamster	WB	Adv Sci (Weinh); DDX3 Regulates the Cap-Independent Translation of the Japanese Encephalitis Virus via Its Interactions with PABP1 and the Untranslated Regions of the Viral Genome; Authors - Chenxi Li