Product Information
15887-1-PBS targets EIF1, EIF1B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8673 Product name: Recombinant human EIF1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC006996 Sequence: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF Predict reactive species |
| Full Name | eukaryotic translation initiation factor 1B |
| Calculated Molecular Weight | 113 aa, 13 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC006996 |
| Gene Symbol | EIF1B |
| Gene ID (NCBI) | 10289 |
| RRID | AB_2878196 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60739 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









