EIF1, EIF1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EIF1, EIF1B Polyclonal antibody, PBS Only (15887-1-PBS)

• 

  WB analysis of L02 using 15887-1-AP (same clone as 15887-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 15887-1-AP (EIF1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15887-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15887-1-AP (same clone as 15887-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15887-1-AP (EIF1B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15887-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15887-1-AP (same clone as 15887-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15887-1-AP (EIF1B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15887-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15887-1-AP (same clone as 15887-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15887-1-AP (EIF1B Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15887-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15887-1-AP (same clone as 15887-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15887-1-AP (EIF1B Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15887-1-PBS in a different storage buffer formulation.

EIF1, EIF1B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15887-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15887-1-PBS targets EIF1, EIF1B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8673

  Product name: Recombinant human EIF1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC006996

  Sequence: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

• Full Name: eukaryotic translation initiation factor 1B
• Calculated Molecular Weight: 113 aa, 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC006996
• Gene Symbol: EIF1B
• Gene ID (NCBI): 10289
• RRID: AB_2878196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60739
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.