EIF2AK4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EIF2AK4 Polyclonal antibody (27944-1-AP)

• 

  WB analysis using 27944-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27944-1-AP (EIF2AK4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human small intestine using 27944-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 27944-1-AP (EIF2AK4 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human small intestine using 27944-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 27944-1-AP (EIF2AK4 antibody) at dilution of 1:100 (under 10x lens).

EIF2AK4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27944-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

EC:2.7.11.1, eIF-2-alpha kinase GCN2, Eukaryotic translation initiation factor 2-alpha kinase 4, GCN2, GCN2 like protein

---

Tested Applications

• Positive WB detected in: HepG2 cells, TT cells
• Positive IHC detected in: human small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27944-1-AP targets EIF2AK4 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27617

  Product name: Recombinant human EIF2AK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 875-1080 aa of BC009350

  Sequence: AFSADSKQDDQTGDLIKSDPSGHLTGMVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA

• Full Name: eukaryotic translation initiation factor 2 alpha kinase 4
• Calculated Molecular Weight: 187 kDa
• Observed Molecular Weight: ~200 kDa
• GenBank Accession Number: BC009350
• Gene Symbol: EIF2AK4
• Gene ID (NCBI): 440275
• RRID: AB_3669630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2K8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; A dietary pan-amino acid dropout screen in vivo reveals a critical role for histidine in T-ALL.; Authors - Komal Mandleywala