EIF2B1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EIF2B1 Polyclonal antibody (18010-1-AP)

• Featured Product
• KD/KO Validated

EIF2B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18010-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Translation initiation factor eIF2B subunit alpha, EIF2BA, eIF2B GDP-GTP exchange factor subunit alpha, EIF2B, EIF 2Balpha

• 

  WB analysis of MCF-7 using 18010-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18010-1-AP (EIF2B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 18010-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 18010-1-AP (EIF2B1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18010-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18010-1-AP (EIF2B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 18010-1-AP

  IP result of anti-EIF2B1 (IP:18010-1-AP, 4ug; Detection:18010-1-AP 1:700) with K-562 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 18010-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18010-1-AP (EIF2B1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 18010-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18010-1-AP (EIF2B1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 18010-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18010-1-AP (EIF2B1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 18010-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18010-1-AP (EIF2B1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 18010-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18010-1-AP (EIF2B1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 18010-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18010-1-AP (EIF2B1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 18010-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EIF2B1 antibody (18010-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF7 cells, HeLa cells, K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: mouse brain tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18010-1-AP targets EIF2B1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12509

  Product name: Recombinant human EIF2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-305 aa of BC103763

  Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL

• Full Name: eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
• Calculated Molecular Weight: 305 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC103763
• Gene Symbol: EIF2B1
• Gene ID (NCBI): 1967
• RRID: AB_2261996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14232
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Nat Microbiol; Inhibition of the integrated stress response by viral proteins that block p-eIF2-eIF2B association.; Authors - Huib H Rabouw
human	WB	Nat Commun; Sugar phosphate activation of the stress sensor eIF2B.; Authors - Qi Hao
human	WB	Elife; Pharmacological dimerization and activation of the exchange factor eIF2B antagonizes the integrated stress response.; Authors - Carmela Sidrauski
	WB	Elife; The small molecule ISRIB rescues the stability and activity of Vanishing White Matter Disease eIF2B mutant complexes.; Authors - Yao Liang Wong
human	WB	Elife; eIF2B conformation and assembly state regulate the integrated stress response.; Authors - Michael Schoof
human, mouse	WB	FASEB J; Analysis of the subunit organization of the eIF2B complex reveals new insights into its structure and regulation.; Authors - Noel C Wortham