EIF2B1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68824-1-Ig (same clone as 68824-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68824-1-Ig (EIF2B1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68824-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 68824-1-Ig (same clone as 68824-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68824-1-Ig (EIF2B1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68824-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68824-1-Ig (same clone as 68824-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EIF2B1 antibody (68824-1-Ig, Clone: 1H6A3 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 68824-1-PBS in a different storage buffer formulation.

EIF2B1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68824-1-PBS

Clone No.1H6A3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, IF/ICC, ELISA

Synonyms

EIF2BA, eIF2B GDP-GTP exchange factor subunit alpha, EIF2B, EIF 2Balpha, EIF 2B

---

Product Information

68824-1-PBS targets EIF2B1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12493

  Product name: Recombinant human EIF2B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-305 aa of BC103763

  Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL

• Full Name: eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
• Calculated Molecular Weight: 305 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC103763
• Gene Symbol: EIF2B1
• Gene ID (NCBI): 1967
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14232
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.