EIF2B5 Polyclonal antibody

• 

  WB analysis using 29935-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29935-1-AP (EIF2B5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 29935-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29935-1-AP (EIF2B5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 29935-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29935-1-AP (EIF2B5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 29935-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using EIF2B5 antibody (29935-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of MCF-7 using 29935-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using EIF2B5 antibody (29935-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

EIF2B5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29935-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CACH, CLE, EIF 2B, EIF2B5, EIF2BE, EIF2Bepsilon, LVWM

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293T cells, HT-29 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29935-1-AP targets EIF2B5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32175

  Product name: Recombinant human EIF2B5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 455-711 aa of NM_003907.2

  Sequence: DAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLK

• Full Name: eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 65-80 kDa
• GenBank Accession Number: NM_003907.2
• Gene Symbol: EIF2B5
• Gene ID (NCBI): 8893
• RRID: AB_2923623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13144
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EIF2B5 encodes translation initiation factor eIF-2B subunit epsilon protein (PMID 8688466). EIF2B5 mutations compromise the induction of GFAP-expressing astrocytes in VWM (vanishing white matter) leukodystrophy (PMID:15723074, PMID:15776425). The upregulation of EIF2B5 is associated with cancer such as human pulmonary adenocarcinoma cell and breast cancer (PMID:24366584, PMID:24979338). EIF2B5 also has 65kDa truncated protein isoform (PMID:28961236).