EIF3C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EIF3C Polyclonal antibody (12733-1-AP)

EIF3C Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12733-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EIF3S8, EIF3CL, eIF3 p110

• 

  WB analysis of K-562 using 12733-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 12733-1-AP (EIF3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 12733-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12733-1-AP (EIF3C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 12733-1-AP

  IP result of anti-EIF3C (IP:12733-1-AP, 4ug; Detection:12733-1-AP 1:500) with K-562 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12733-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12733-1-AP (EIF3C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 12733-1-AP

  Immunohistochemical analysis of paraffin-embedded stomach cancer slide using 12733-1-AP (EIF3C antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12733-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12733-1-AP (EIF3C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human stomach cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12733-1-AP targets EIF3C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3438

  Product name: Recombinant human EIF3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC001571

  Sequence: MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEI

• Full Name: eukaryotic translation initiation factor 3, subunit C
• Calculated Molecular Weight: 913 aa, 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC001571
• Gene Symbol: EIF3C
• Gene ID (NCBI): 8663
• RRID: AB_2096747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; IGF2BP3 recruits NUDT21 to regulate SPTBN1 alternative polyadenylation and drive ovarian cancer progression; Authors - Xin Luo
	WB	Cell Mol Biol Lett; The promoting roles of GLP1R and GIPR in stemness maintenance and multiple lineage-specific differentiation of PDLSCs.; Authors - Yifen Shen
human	WB	Cell Death Differ; Loss of SMURF2 expression enhances RACK1 stability and promotes ovarian cancer progression; Authors - Yanan Pi
mouse	IF	Cell Rep; Proximity labeling proteomics maps radial glial ciliary proteins across the developing telencephalon.; Authors - Xiaoliang Liu
human	WB	Cell Rep; A bicistronic viral genome uses a compact type IV IRES near its 3' end to express a transmembrane protein.; Authors - Madeline E. Sherlock
		bioRxiv; A compact viral IRES translates a downstream open reading frame; Authors - Madeline E Sherlock