EIF3D Polyclonal antibody

• 

  WB analysis of mouse brain using 10219-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10219-1-AP

  WB result of EIF3D antibody (10219-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EIF3D transfected HEK-293 cells.

• 

  WB analysis using 10219-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10219-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10219-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 10219-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 10219-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 10219-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 10219-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10219-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A549 using 10219-1-AP

  IP result of anti-EIF3D (IP:10219-1-AP, 4ug; Detection:10219-1-AP 1:300) with A549 cells lysate 2800 ug.

• 

  IHC staining of human breast cancer using 10219-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10219-1-AP (EIF3D Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 10219-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10219-1-AP (EIF3D Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining using 10219-1-AP

  IF result of 10219-1-AP (anti-EIF3D) in U2OS cell (treated with 100 mM sodium arsenite to cause stress-induced translational arrest) by Dr. Nancy Kedersha.U2OS cells (FAST-YFP stables; but not showing FAST-YFP); stained with PTG anti-eIF3p66 in green; and counterstained with anti-eIF3b (goat polyclonal) in red; nuclei stained blue using Hoechst.

• 

  IF Staining of HepG2 using 10219-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF3D antibody (10219-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of transfected cells using 10219-1-AP

  IF result of 10219-1-AP (anti-EIF3D) in U2OS cell by Dr. Nancy Kedersha. U2OS cells (FAST-YFP stables; but not showing FAST-YFP); stained with 10219-1-AP (EIF3D) in green; and counterstained with Santa Cruz anti-eIF3b (goat polyclonal) in red; nuclei stained blue using Hoechst.; The EIF3D(p66) appears associated with mitochondria.

• 

  IF Staining of HepG2 using 10219-1-AP

  Immunofluorescent analysis of HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

• 

  IF Staining of HepG2 using 10219-1-AP

  Immunofluorescent analysis of Ethacrynic acid treated HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

• 

  IF Staining of HepG2 using 10219-1-AP

  Immunofluorescent analysis of HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

• 

  IF Staining of HepG2 using 10219-1-AP

  Immunofluorescent analysis of Ethacrynic acid treated HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

• 

  IF Staining of MCF-7 using 10219-1-AP

  Immunofluorescent analysis of MCF-7 cells, using EIF3D antibody 10219-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

EIF3D Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10219-1-AP

Publications(24)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, yeast and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA

Synonyms

Eukaryotic translation initiation factor 3 subunit 7, eIF-3-zeta, EIF3S7, eIF3 zeta, eIF3 p66

---

Tested Applications

• Positive WB detected in: mouse brain tissue, A549 cells, HepG2 cells, human brain tissue, L02 cells, HEK-293 cells, Jurkat cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, Ethacrynic acid treated HepG2 cells, transfected cells, N/A, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 18 publications below
• IHC: See 1 publications below
• IF: See 3 publications below
• CoIP: See 1 publications below

Product Information

10219-1-AP targets EIF3D in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, yeast samples.

• Tested Reactivity: human, mouse, yeast
• Cited Reactivity: human, mouse, rat, rabbit, yeast
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0268

  Product name: Recombinant human EIF3D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-531 aa of BC000328

  Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

• Full Name: eukaryotic translation initiation factor 3, subunit D
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC000328
• Gene Symbol: EIF3D
• Gene ID (NCBI): 8664
• RRID: AB_2096880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15371
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules; Authors - Qinqin Cui
mouse	WB	Mol Cell; Heterogeneous Ribosomes Preferentially Translate Distinct Subpools of mRNAs Genome-wide.; Authors - Zhen Shi
human	WB	Sci Adv; EIF3D safeguards the homeostasis of key signaling pathways in human primed pluripotency; Authors - Chikako Okubo
human	WB	Nat Commun; A translational program that suppresses metabolism to shield the genome.; Authors - Nathan C Balukoff
human	IHC	EBioMedicine; PMID: 31669222; Authors - Hai Huang
mouse	WB	Dev Cell; Controlling tissue patterning by translational regulation of signaling transcripts through the core translation factor eIF3c; Authors - Kotaro Fujii

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tobias (Verified Customer) (10-25-2022)

clean and good antibody for wb

• Applications: Western Blot

FH

Peter (Verified Customer) (10-24-2022)

Specific band at correct MW

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: A549

FH

Joleen (Verified Customer) (06-10-2019)

EIF3D antibody recognizes a prominent band around the correct molecular weight.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

EIF3D Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:10219-1-AP)