Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EIF3D Polyclonal antibody

EIF3D Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, yeast and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA

Eukaryotic translation initiation factor 3 subunit 7, eIF-3-zeta, EIF3S7, eIF3 zeta, eIF3 p66

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for EIF3D in ?

Tested Applications

Positive WB detected inmouse brain tissue, A549 cells, HepG2 cells, human brain tissue, L02 cells, HEK-293 cells, Jurkat cells
Positive IP detected inA549 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, Ethacrynic acid treated HepG2 cells, transfected cells, N/A, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10219-1-AP targets EIF3D in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, yeast samples.

Tested Reactivity human, mouse, yeast
Cited Reactivityhuman, mouse, rat, rabbit, yeast
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0268

Product name: Recombinant human EIF3D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 323-531 aa of BC000328

Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit D
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC000328
Gene Symbol EIF3D
Gene ID (NCBI) 8664
RRIDAB_2096880
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15371
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.

Protocols

Product Specific Protocols
IF protocol for EIF3D antibody 10219-1-APDownload protocol
IHC protocol for EIF3D antibody 10219-1-APDownload protocol
IP protocol for EIF3D antibody 10219-1-APDownload protocol
WB protocol for EIF3D antibody 10219-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The EIF3D antibody (Cat# 10219-1-AP) has accumulated 35 citations across journals including Cell, Nature Biotechnology, Nature Microbiology, Nature Communications, Molecular Cell, Science Advances, Developmental Cell, Cell Reports, EBioMedicine, Oncogene, EMBO Journal, and others. Research fields span translation initiation, stress granule biology, cancer (lung, gastric, renal, ovarian, bladder), liver fibrosis, viral replication, stem cell pluripotency, ferroptosis, preeclampsia, and myocardial injury.

SpeciesApplicationTitle
humanWB

Cell

Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules

Authors - Qinqin Cui
humanWB

Nat Biotechnol

Branched chemically modified poly(A) tails enhance the translation capacity of mRNA

Authors - Hongyu Chen
  • KD Validated
humanWB

Nat Microbiol

Distinct non-canonical translation initiation modes arise for specific host and viral mRNAs during poxvirus-induced shutoff

Authors - Chorong Park
  • KD Validated
humanWB

Nat Commun

A translational program that suppresses metabolism to shield the genome.

Authors - Nathan C Balukoff
human, mouseWB,IHC,IF

Redox Biol

Integrated stress response-mediated metabolic reprogramming drives hepatic stellate cell activation and liver fibrosis via the noncanonical EIF3d-ATF4-S100P signaling pathway.

Authors - Simin Yang
  • KD Validated
mouseWB

Mol Cell

Heterogeneous Ribosomes Preferentially Translate Distinct Subpools of mRNAs Genome-wide.

Authors - Zhen Shi

Reviews

    5.0 out of 5
Add a review

3 verified customer reviews

What customers say

All three reviews are 5-star ratings for Western Blot. Users consistently report clean, specific bands at the correct molecular weight. One reviewer noted it works well on A549 cells at 1:500 dilution, another confirmed a prominent band in MDCK GII cells at 1:1000 dilution, and a third simply described it as a "clean and good antibody for WB." Overall, customers are highly satisfied with its specificity and performance in Western blotting.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Tobias (Verified Customer) (10-25-2022)

clean and good antibody for wb

  • Applications: Western Blot

Peter (Verified Customer) (10-24-2022)

Specific band at correct MW

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: A549

Joleen (Verified Customer) (06-10-2019)

EIF3D antibody recognizes a prominent band around the correct molecular weight.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1k
  • Cell Tissue Type: MDCK GII
EIF3D Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:10219-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...