Tested Applications
| Positive WB detected in | mouse brain tissue, A549 cells, HepG2 cells, human brain tissue, L02 cells, HEK-293 cells, Jurkat cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, Ethacrynic acid treated HepG2 cells, transfected cells, N/A, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10219-1-AP targets EIF3D in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, yeast samples.
| Tested Reactivity | human, mouse, yeast |
| Cited Reactivity | human, mouse, rat, rabbit, yeast |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0268 Product name: Recombinant human EIF3D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 323-531 aa of BC000328 Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE Predict reactive species |
| Full Name | eukaryotic translation initiation factor 3, subunit D |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 66 kDa |
| GenBank Accession Number | BC000328 |
| Gene Symbol | EIF3D |
| Gene ID (NCBI) | 8664 |
| RRID | AB_2096880 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15371 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EIF3D antibody 10219-1-AP | Download protocol |
| IHC protocol for EIF3D antibody 10219-1-AP | Download protocol |
| IP protocol for EIF3D antibody 10219-1-AP | Download protocol |
| WB protocol for EIF3D antibody 10219-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EIF3D antibody (Cat# 10219-1-AP) has accumulated 35 citations across journals including Cell, Nature Biotechnology, Nature Microbiology, Nature Communications, Molecular Cell, Science Advances, Developmental Cell, Cell Reports, EBioMedicine, Oncogene, EMBO Journal, and others. Research fields span translation initiation, stress granule biology, cancer (lung, gastric, renal, ovarian, bladder), liver fibrosis, viral replication, stem cell pluripotency, ferroptosis, preeclampsia, and myocardial injury.
| Species | Application | Title |
|---|---|---|
Cell Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules | ||
Nat Biotechnol Branched chemically modified poly(A) tails enhance the translation capacity of mRNA
| ||
Nat Microbiol Distinct non-canonical translation initiation modes arise for specific host and viral mRNAs during poxvirus-induced shutoff
| ||
Redox Biol Integrated stress response-mediated metabolic reprogramming drives hepatic stellate cell activation and liver fibrosis via the noncanonical EIF3d-ATF4-S100P signaling pathway.
| ||
Mol Cell Heterogeneous Ribosomes Preferentially Translate Distinct Subpools of mRNAs Genome-wide. |
Reviews
What customers say
All three reviews are 5-star ratings for Western Blot. Users consistently report clean, specific bands at the correct molecular weight. One reviewer noted it works well on A549 cells at 1:500 dilution, another confirmed a prominent band in MDCK GII cells at 1:1000 dilution, and a third simply described it as a "clean and good antibody for WB." Overall, customers are highly satisfied with its specificity and performance in Western blotting.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tobias (Verified Customer) (10-25-2022) | clean and good antibody for wb
|
Peter (Verified Customer) (10-24-2022) | Specific band at correct MW
|
Joleen (Verified Customer) (06-10-2019) | EIF3D antibody recognizes a prominent band around the correct molecular weight.
 |
