CoraLite® Plus 488-conjugated EIF3D Monoclonal antibody

EIF3D Monoclonal Antibody for IF/ICC
Cat No. CL488-66024
Clone No.2C5A3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC

eIF 3 zeta, eIF3 p66, eIF3 zeta, EIF3D, EIF3S7

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66024 targets EIF3D in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18092

Product name: Recombinant human EIF3D protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 323-531 aa of BC000328

Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit D
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC000328
Gene Symbol EIF3D
Gene ID (NCBI) 8664
RRIDAB_2883231
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15371
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EIF3D antibody CL488-66024Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...