Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EIF3D Monoclonal antibody

EIF3D Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66024-1-Ig
Clone No. 2C5A3
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

eIF-3-zeta, EIF3S7, eIF3 zeta, eIF3 p66, eIF 3 zeta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for EIF3D in ?

Tested Applications

Positive WB detected inHepG2 cells, A431 cells, HEK-293 cells, HeLa cells, human brain tissue, mouse liver tissue, rat liver tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66024-1-Ig targets EIF3D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18092

Product name: Recombinant human EIF3D protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 323-531 aa of BC000328

Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit D
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC000328
Gene Symbol EIF3D
Gene ID (NCBI) 8664
RRIDAB_11042451
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15371
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.

Protocols

Product Specific Protocols
IF protocol for EIF3D antibody 66024-1-IgDownload protocol
IHC protocol for EIF3D antibody 66024-1-IgDownload protocol
WB protocol for EIF3D antibody 66024-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The EIF3D Monoclonal antibody (2C5A3), catalog number 66024-1-Ig, has 1 citation to date. It was used in a Western blot study published in Aging (Albany NY) (2024), investigating how the RNA splicing regulator EIF3D modulates the tumor microenvironment through immunogene-related alternative splicing in head and neck squamous cell carcinoma. The research falls within the fields of cancer biology, RNA splicing regulation, and tumor immunology.

SpeciesApplicationTitle
humanWB

Aging (Albany NY)

RNA splicing regulator EIF3D regulates the tumor microenvironment through immunogene-related alternative splicing in head and neck squamous cell carcinoma

Authors - Dandan Lu
Loading...
||
New chat

Able™

正在加载,请稍候...