EIF3D Monoclonal antibody

• 

  WB analysis of HepG2 using 66024-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66024-1-Ig

  WB result of EIF3D antibody (66024-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EIF3D transfected HEK-293 cells.

• 

  WB analysis of human brain using 66024-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66024-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 66024-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66024-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 66024-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 66024-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 66024-1-Ig (EIF3D antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 66024-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain using 66024-1-Ig(EIF3D antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 66024-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain using 66024-1-Ig(EIF3D antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 66024-1-Ig

  Immunofluorescent analysis of (10% Formaldehyde ) fixed HeLa cells using 66024-1-Ig(EIF3D antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

EIF3D Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66024-1-Ig

Clone No.2C5A3

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

eIF-3-zeta, EIF3S7, eIF3 zeta, eIF3 p66, eIF 3 zeta

---

Tested Applications

• Positive WB detected in: HepG2 cells, A431 cells, HEK-293 cells, HeLa cells, human brain tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66024-1-Ig targets EIF3D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18092

  Product name: Recombinant human EIF3D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 323-531 aa of BC000328

  Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

• Full Name: eukaryotic translation initiation factor 3, subunit D
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC000328
• Gene Symbol: EIF3D
• Gene ID (NCBI): 8664
• RRID: AB_11042451
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15371
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Aging (Albany NY); RNA splicing regulator EIF3D regulates the tumor microenvironment through immunogene-related alternative splicing in head and neck squamous cell carcinoma; Authors - Dandan Lu