EIF3F Recombinant monoclonal antibody, PBS Only (Detector)

EIF3F Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 84131-2-PBS
Clone No.240894D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

240894D2, eIF3 p47

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84131-2-PBS targets EIF3F as part of a matched antibody pair:

MP01038-4: 84131-1-PBS capture and 84131-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34849

Product name: Recombinant human EIF3F protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 105-357 aa of BC000490

Sequence: SYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit F
Calculated Molecular Weight 38 kDa
Observed Molecular Weight40-45 kDa
GenBank Accession NumberBC000490
Gene Symbol EIF3F
Gene ID (NCBI) 8665
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00303
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EIF3F (eukaryotic translation initiation factor 3 subunit F) is a protein that plays an important role in eukaryotic cells and is an integral part of the translation initiation factor 3(Eif3) complex. EIF3 is a complex of at least 10 distinct subunits and is the largest translation initiation factor in eukaryotes.

Loading...
||
New chat

Able

正在加载,请稍候...