EIF4B Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• EIF4B Recombinant monoclonal antibody, PBS Only (88367-1-PBS)

EIF4B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 88367-1-PBS

Clone No.260892A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EIF 4B, eIF-4B, PRO1843

• 

  WB analysis using 88367-1-RR (same clone as 88367-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88367-1-RR (EIF4B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88367-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 88367-1-RR (same clone as 88367-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using EIF4B antibody (88367-1-RR, Clone: 260892A7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88367-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88367-1-PBS targets EIF4B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12325

  Product name: Recombinant human EIF4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC073154

  Sequence: MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS

• Full Name: eukaryotic translation initiation factor 4B
• Calculated Molecular Weight: 611 aa, 69 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC073154
• Gene Symbol: EIF4B
• Gene ID (NCBI): 1975
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23588
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EIF4B is one of the mammalian eukaryotic initiation factors (eIF) that are required for the ATP-dependent binding of mRNA to the 40 S ribosomal subunit, and the other eIF proteins are EIF4A, EIF4F. eIF4B is involved in translation of numerous proliferative or anti-apoptotic mRNAs with highly structured 5'UTR and subsequently affect cell growth and survival. It was reported that false expression and phosphorylation levels of eIF4B are involved in several tumors including breast cancer, cell lymphoblastic leukemia and diffuse large B-cell lymphoma (PMID: 26848623).