EIF4B Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• EIF4B Recombinant monoclonal antibody, PBS Only (Capture) (88367-3-PBS)

EIF4B Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 88367-3-PBS

Clone No.260892E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

EIF 4B, eIF-4B, PRO1843

• 

  Cytometric bead array sample test of MP03486-1

  The mean EIF4B concentration was determined to be 247.9 ng/mL in Hela cell extract based on a 1.0 mg/mL extract load, 122.5 ng/mL in HEK-293 cell extract based on a 1.0 mg/mL extract load, 87.1 ng/mL in MCF-7 cell extract based on a 1.0 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03486-1

  Cytometric bead array standard curve of MP03486-1, EIF4B Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88367-3-PBS. Detection antibody: 88367-2-PBS. Standard: Ag12325. Range: 0.156-20 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88367-3-PBS targets EIF4B as part of a matched antibody pair:

MP03486-1: 88367-3-PBS capture and 88367-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12325

  Product name: Recombinant human EIF4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC073154

  Sequence: MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS

• Full Name: eukaryotic translation initiation factor 4B
• Calculated Molecular Weight: 611 aa, 69 kDa
• GenBank Accession Number: BC073154
• Gene Symbol: EIF4B
• Gene ID (NCBI): 1975
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23588
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.