EIF4E Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• EIF4E Recombinant monoclonal antibody (89091-1-RR)

EIF4E Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 89091-1-RR Copied!

Clone No. 262243C4

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

eIF 4E, eIF-4E, EIF4EL1, EIF4F, eIF-4F 25 kDa subunit

• 

  WB analysis using 89091-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 89091-1-RR (EIF4E antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 89091-1-RR

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 89091-1-RR (EIF4E antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 89091-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EIF4E antibody (89091-1-RR, Clone: 262243C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 89091-1-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug EIF4E Recombinant monoclonal antibody (89091-1-RR, Clone:262243C4)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 89091-1-RR

  Biolayer interferometry (BLI) kinetic assays of 89091-1-RR against Human EIF4E were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EIF4E in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HSC-T6 cells, Jurkat cells, K-562 cells, Calu-3 cells, NIH/3T3 cells
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

89091-1-RR targets EIF4E in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27191

  Product name: Recombinant human EIF4E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-217 aa of BC012611

  Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

• Full Name: eukaryotic translation initiation factor 4E
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 26-29 kDa
• GenBank Accession Number: BC012611
• Gene Symbol: EIF4E
• Gene ID (NCBI): 1977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06730
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins. This is a rabbit polyclonal antibody raised against the full-length human EIF4E.