eIF4G2/DAP5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• eIF4G2/DAP5 Polyclonal antibody (17728-1-AP)

eIF4G2/DAP5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17728-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

EIF4G2, AAG1, DAP 5, DAP5, DAP-5

• 

  WB analysis using 17728-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17728-1-AP (DAP5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17728-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17728-1-AP (eIF4G2/DAP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 17728-1-AP

  IP result of anti-eIF4G2/DAP5 (IP:17728-1-AP, 4ug; Detection:17728-1-AP 1:400) with MCF-7 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 17728-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 17728-1-AP (eIF4G2/DAP5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 17728-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 17728-1-AP (eIF4G2/DAP5 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 17728-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 17728-1-AP (eIF4G2/DAP5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 17728-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 17728-1-AP (eIF4G2/DAP5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 17728-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using eIF4G2/DAP5 antibody (17728-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for eIF4G2/DAP5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A172 cells, Jurkat cells, MCF-7 cells, U-87 MG cells, Neuro-2a cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human prostate cancer tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17728-1-AP targets eIF4G2/DAP5 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12125

  Product name: Recombinant human EIF4G2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 563-907 aa of BC043149

  Sequence: EAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD

• Full Name: eukaryotic translation initiation factor 4 gamma, 2
• Calculated Molecular Weight: 907 aa, 102 kDa
• Observed Molecular Weight: 98-102 kDa
• GenBank Accession Number: BC043149
• Gene Symbol: EIF4G2
• Gene ID (NCBI): 1982
• RRID: AB_2095895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78344
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

eIF4G2, also commonly known as DAP5 (Death-Associated Protein 5) or p97, is a crucial and unique member of the eukaryotic translation initiation factor machinery. Unlike its canonical counterpart eIF4G1, which is central to the cap-dependent translation of most cellular mRNAs, eIF4G2/DAP5 functions as a key regulator and facilitator of alternative, cap-independent translation under both normal and stress conditions.

Publications

What published studies show

Anti-EIF4G2 (17728-1-AP) has 8 citations across journals including Nature Communications, Journal of Advanced Research, Cancer Letters, Developmental Cell, Journal of Proteome Research, Shock, and Gene. Research fields span hepatocellular carcinoma, gallbladder cancer, pancreatic ductal adenocarcinoma, lung adenocarcinoma, ischemic stroke, intestinal epithelial barrier recovery, and pre-ribosomal particle biology, with applications primarily in Western blot and RIP.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; The protein circPETH-147aa regulates metabolic reprogramming in hepatocellular carcinoma cells to remodel immunosuppressive microenvironment; Authors - Tian Lan
human	WB	Nat Commun; PMID: 31792210; Authors - Sunwang Xu
mouse	WB	J Adv Res; Endothelial cells secrete small extracellular vesicles to promote neuron endoplasmic reticulum stress injury via miR-146a-5p/Eif4g2 axis in ischemic stroke; Authors - Meiqi Jin
human	WB	Cancer Lett; circPLEKHM1 promotes tumor growth and metastasis through enhancing FXR1-mediated protein translation in PDAC.; Authors - Yang Yang
human	WB,RIP	Dev Cell; CircRNA-encoded RIPK1-98 protein drives lung adenocarcinoma progression.; Authors - Qi Sun
human	WB,RIP	J Proteome Res; EIF4G2 Promotes Hepatocellular Carcinoma Progression via IRES-dependent PLEKHA1 Translation Regulation; Authors - Manman Li ; KD Validated