• Featured Product
  • KD/KO Validated

EIF4H Polyclonal antibody

EIF4H Polyclonal Antibody for WB, ELISA
Cat No. 11012-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

eIF 4H, EIF4H, KIAA0038, WBSCR1, WSCR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, PC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11012-1-AP targets EIF4H in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1468

Product name: Recombinant human EIF4H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-188 aa of BC010021

Sequence: MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQR

Predict reactive species
Full Name eukaryotic translation initiation factor 4H
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC010021
Gene Symbol EIF4H
Gene ID (NCBI) 7458
RRIDAB_2096035
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15056
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

eukaryotic initiation factor (eIF)4H, which encoded by the gene for HUMORFU_1, functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. And its homolog in human, WBSCR1, located on 7q11, is commonly missed in patients suffered the Williams-Beuren syndrome, which is a complex neurodevelopmental disorder characterized by cardiovascular defects, cerebral dysplasias and a peculiar cognitive-behavioral profile. EIF4H has two kind of isoforms. The short isoform(~25kDa) is the predominant isoform and is expressed alone in liver and skeletal muscle. This is a rabbit anti-EIF4H polyclonal antibody raised against part of N-terminal chain of human EIF4H, and can recognize two kinds of isoform.

Protocols

Product Specific Protocols
WB protocol for EIF4H antibody 11012-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Virol

Small interfering RNAs that deplete the cellular translation factor eIF4H impede mRNA degradation by the virion host shutoff protein of herpes simplex virus.

Authors - Sarma Nandini N
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...