Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11155-1-AP targets EIF5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1629 Product name: Recombinant human EIF5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC032866 Sequence: MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNN Predict reactive species |
| Full Name | eukaryotic translation initiation factor 5 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC032866 |
| Gene Symbol | EIF5 |
| Gene ID (NCBI) | 1983 |
| RRID | AB_2877748 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55010 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Eukaryotic translation initiation factor 5, also named as EIF5, is a 431 amino acid protein, which contains one W2 domain and belongs to the eIF-2-beta/eIF-5 family. EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. EIF5 plays multiple roles in translation initiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EIF5 antibody 11155-1-AP | Download protocol |
| IHC protocol for EIF5 antibody 11155-1-AP | Download protocol |
| IP protocol for EIF5 antibody 11155-1-AP | Download protocol |
| WB protocol for EIF5 antibody 11155-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-eIF1 antibody (Cat# 11155-1-AP) has 7 total citations published in Nature, Nucleic Acids Research, Advanced Science, International Journal of Molecular Sciences, Journal of Molecular Biology, Frontiers in Oncology, and bioRxiv. Research fields span translation initiation regulation during mitosis, cap-independent viral translation, RANKL signaling in dairy goats, circular RNA degradation via nonsense-mediated mRNA decay, and mTOR pathway involvement in hepatocellular carcinoma prognosis.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res An interaction between eIF4A3 and eIF3g drives the internal initiation of translation | ||
Adv Sci (Weinh) DDX3 Regulates the Cap-Independent Translation of the Japanese Encephalitis Virus via Its Interactions with PABP1 and the Untranslated Regions of the Viral Genome | ||
Int J Mol Sci The High Level of RANKL Improves IκB/p65/Cyclin D1 Expression and Decreases p-Stat5 Expression in Firm Udder of Dairy Goats | ||
J Mol Biol Translatable Circular RNAs are Degraded Via Nonsense-mediated mRNA Decay.
| ||
Front Oncol CircRNA-100338 Is Associated With mTOR Signaling Pathway and Poor Prognosis in Hepatocellular Carcinoma. |
Reviews
What customers say
One reviewer rated this antibody 5/5, praising its performance in Western Blot on MCF7 cell lysates. They reported it works perfectly at a 1:500 dilution in 5% BSA/TBST, whether incubated overnight at 4°C or for just 2 hours at room temperature. Overall, the feedback highlights reliable and flexible WB results with this product.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Adrianna (Verified Customer) (10-24-2022) | Very good antibody for WB application in cell line lysate. Works perfectly at 1:500 dilution in 5% BSA in TBST either at 4 deg C over night or for 2h at room temperature.
|
