• Featured Product
  • KD/KO Validated

EIF5A Polyclonal antibody

EIF5A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 11309-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

eIF-5A, eIF-4D, eIF 5A1, eIF 5A 1, EIF 5A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells, PC-3 cells, SH-SY5Y cells, mouse brain tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11309-1-AP targets EIF5A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1849

Product name: Recombinant human EIF5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-154 aa of BC001832

Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Predict reactive species
Full Name eukaryotic translation initiation factor 5A
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC001832
Gene Symbol EIF5A
Gene ID (NCBI) 1984
RRIDAB_2262001
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63241
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Translation of messenger RNA (mRNA) to protein in eukaryotesis a crucial process in protein biosynthesis, in which initiation of translation involves interaction of different eukaryotic translation initiation factors (eIFs), ribosome subunits and mRNAs. Eukaryotic translation initiation factor 5A (EIF5A) is one of the eIFs involved in translation initiation. EIF5A has a essential role in cell viability and the only protein known to contain the amino acid residue hypusine, formed by post-translational modification of a specific lysine residue. Firstly identified as a translation initiation factor, it also has a function in the elongation step of translation.

Protocols

Product Specific Protocols
IF protocol for EIF5A antibody 11309-1-APDownload protocol
IHC protocol for EIF5A antibody 11309-1-APDownload protocol
WB protocol for EIF5A antibody 11309-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

J Cancer

EIF5A expression and its role as a potential diagnostic biomarker in hepatocellular carcinoma.

Authors - Linjing Li
mouseIF

J Ovarian Res

Proteomic analysis implicates that postovulatory aging leads to aberrant gene expression, biosynthesis, RNA metabolism and cell cycle in mouse oocytes

Authors - Chuanxin Zhang
humanWB

Oncol Lett

SHCBP1 contributes to the proliferation and self‑renewal of cervical cancer cells and activation of the NF‑κB signaling pathway through EIF5A

Authors - Boya Deng
humanWB

Nat Chem Biol

ENO1 promotes liver carcinogenesis through YAP1-dependent arachidonic acid metabolism

Authors - Linchong Sun
  • KD Validated
humanWB

Oral Dis

ZNF331 Represses the Proliferation of Head and Neck Squamous Cell Carcinoma via Co-Repressor TRIM28

Authors - Ju Li

BMC Cancer

Multi-omics analysis reveals the impact of YAP/TEAD4-mediated EIF5A1 expression on mitochondrial apoptosis and bladder cancer progression

Authors - Kun-Peng Li
Loading...
||
New chat Able
正在加载,请稍候...