EIF5A Monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP50372-1

  Sandwich ELISA standard curve of MP50372-1, Human EIF5A Monoclonal Matched Antibody Pair - PBS only. 67214-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1849. 67214-3-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL

• 

  Sample test of MP50372-1

  The mean EIF5A concentration was determined to be 135.22 ng/mL in HEK-293 cell extract based on a 2.2 mg/mL extract load, 102.87 ng/mL in HeLa cell extract based on a 1.8 mg/mL extract load and 124.18 ng/mL in A549 cell extract based on a 3.1 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP50372-1

  Cytometric bead array standard curve of MP50372-1, EIF5A Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67214-2-PBS. Detection antibody: 67214-3-PBS. Standard:Ag1849. Range: 1.563-50 ng/mL.

EIF5A Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 67214-3-PBS

Clone No.1D6C11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

eIF-4D, eIF 5A1, eIF 5A 1, EIF 5A, eIF 4D

---

Product Information

67214-3-PBS targets EIF5A as part of a matched antibody pair:

MP50372-1: 67214-2-PBS capture and 67214-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28588

  Product name: Recombinant human EIF5A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-154 aa of BC001832

  Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

• Full Name: eukaryotic translation initiation factor 5A
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: BC001832
• Gene Symbol: EIF5A
• Gene ID (NCBI): 1984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P63241
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.