EIF6 Monoclonal antibody, PBS Only

EIF6 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68765-3-PBS
Clone No.1F2A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

integrin beta 4 binding protein, CAB, B4 integrin interactor, B(2)GCN homolog, b(2)gcn

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68765-3-PBS targets EIF6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30249

Product name: Recombinant human EIF6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-245 aa of BC001119

Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Predict reactive species
Full Name eukaryotic translation initiation factor 6
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC001119
Gene Symbol EIF6
Gene ID (NCBI) 3692
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56537
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

p27(BBP/eIF6) is an evolutionarily conserved protein that was originally identified as p27(BBP), it functions as an interactor of the cytoplasmic domain of integrin 4 and as the putative translation initiation factor eIF6. p27BBP is found in two pools: one nuclear pool enriched in the perinucleolar region, and one cytoplasmic pool. p27BBP binds to the fibronectin type III domains of integrin 4 subunit (ITGB4), an important functional component of hemidesmosomes, and help link ITGB4 to the intermediate filament cytoskeleton. In vitro and in vivo studies demonstrated that p27BBP is essential for cell viability and has a primary function in the biogenesis of the 60S ribosomal subunit. p27BBP protein is increased in rapidly cycling cells and decreased in villous cells committed to apoptotic cell death. In dysplastic colorectal adenomas and carcinomas, p27BBP displayed a large increase of its nucleolar component and was associated with the nuclear matrix. In particular, p27BBP increased progressively from adenomas to carcinomas and was related to the tumor stage.

Loading...
||
New chat

Able

正在加载,请稍候...