• Featured Product
  • KD/KO Validated

EIF6 Recombinant monoclonal antibody, PBS Only

EIF6 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82693-1-PBS
Clone No.2G23

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

integrin beta 4 binding protein, 2G23, b, b(2)gcn, B(2)GCN homolog

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82693-1-PBS targets EIF6 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0324

Product name: Recombinant human EIF6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC001119

Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Predict reactive species
Full Name eukaryotic translation initiation factor 6
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC001119
Gene Symbol EIF6
Gene ID (NCBI) 3692
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56537
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

p27(BBP/eIF6) is an evolutionarily conserved protein that was originally identified as p27(BBP), it functions as an interactor of the cytoplasmic domain of integrin 4 and as the putative translation initiation factor eIF6. p27BBP is found in two pools: one nuclear pool enriched in the perinucleolar region, and one cytoplasmic pool. p27BBP binds to the fibronectin type III domains of integrin 4 subunit (ITGB4), an important functional component of hemidesmosomes, and help link ITGB4 to the intermediate filament cytoskeleton. In vitro and in vivo studies demonstrated that p27BBP is essential for cell viability and has a primary function in the biogenesis of the 60S ribosomal subunit. p27BBP protein is increased in rapidly cycling cells and decreased in villous cells committed to apoptotic cell death. In dysplastic colorectal adenomas and carcinomas, p27BBP displayed a large increase of its nucleolar component and was associated with the nuclear matrix. In particular, p27BBP increased progressively from adenomas to carcinomas and was related to the tumor stage.

Loading...
||
New chat

Able

正在加载,请稍候...