ELA3A Polyclonal antibody

• 

ELA3A Polyclonal Antibody for ELISA

Cat No. 15737-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

CELA3A, ELA3, ELA3A, Elastase 3A, elastase 3A, pancreatic, Elastase IIIA, Protease E

---

Product Information

15737-1-AP targets ELA3A in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8536

  Product name: Recombinant human ELA3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-270 aa of BC008383

  Sequence: SSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH

• Full Name: elastase 3A, pancreatic
• Calculated Molecular Weight: 270 aa, 29 kDa
• GenBank Accession Number: BC008383
• Gene Symbol: ELA3A
• Gene ID (NCBI): 10136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09093
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.