ELF4 Polyclonal antibody

• 

ELF4 Polyclonal Antibody for ELISA

Cat No. 27423-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

E74 like factor 4, ELF4, ELFR, MEF, Myeloid Elf 1 like factor

---

Product Information

27423-1-AP targets ELF4 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26589

  Product name: Recombinant human ELF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-515 aa of BC017194

  Sequence: EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLLAGANRPTNPAPPTVTGAGPAGPSSQ

• Full Name: E74-like factor 4 (ets domain transcription factor)
• Calculated Molecular Weight: 663 aa, 71 kDa
• GenBank Accession Number: BC017194
• Gene Symbol: ELF4
• Gene ID (NCBI): 2000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99607
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.