ELF4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ELF4 Polyclonal antibody (27423-1-AP)

• 

  WB analysis using 27423-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27423-1-AP (ELF4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 27423-1-AP

  IP result of anti-ELF4 (IP:27423-1-AP, 4ug; Detection:27423-1-AP 1:600) with K-562 cells lysate 1760 ug.

ELF4 Polyclonal Antibody for WB, IP, ELISA

Cat No. 27423-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

E74 like factor 4

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27423-1-AP targets ELF4 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26589

  Product name: Recombinant human ELF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-515 aa of BC017194

  Sequence: EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVAPVGSGSALTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPAASTFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLLAGANRPTNPAPPTVTGAGPAGPSSQ

• Full Name: E74-like factor 4 (ets domain transcription factor)
• Calculated Molecular Weight: 663 aa, 71 kDa
• Observed Molecular Weight: 71 kDa, 90~100 kDa
• GenBank Accession Number: BC017194
• Gene Symbol: ELF4
• Gene ID (NCBI): 2000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99607
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELF4 (E74-like ETS transcription factor 4), also widely known as MEF (Myeloid Elf-1-like factor), is a protein-coding gene in humans located on the X chromosome. It encodes a sequence-specific DNA-binding transcription factor that belongs to the evolutionary conserved ETS family. ELF4 is abundantly expressed in normal human hematopoietic tissues. It modulates the cell cycle, ensuring a balanced transition of hematopoietic stem cells and endothelial cells between a resting (quiescent) phase and active cell division (PMID: 40083328). IP analysis detected bands at 71 kDa, while the 90~100 kDa band could be post-translational modification.