ELK1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ELK1 Recombinant monoclonal antibody, PBS Only (87009-3-PBS)

ELK1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87009-3-PBS

Clone No.252085A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ELK, ELK 1, ETS domain-containing protein Elk-1

• 

  WB analysis using 87009-3-RR (same clone as 87009-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87009-3-RR (ELK1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87009-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87009-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87009-3-RR against Human ELK1 were performed. The affinity constant is 4.94 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87009-3-PBS targets ELK1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26683

  Product name: Recombinant human ELK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-320 aa of BC056150

  Sequence: TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE

• Full Name: ELK1, member of ETS oncogene family
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 58-60 kDa
• GenBank Accession Number: BC056150
• Gene Symbol: ELK1
• Gene ID (NCBI): 2002
• RRID: AB_3745271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19419
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ELK1 is a nuclear transcription factor of the ETS-domain family and the ternary complex factor (TCF) sub-family. It binds to purine-rich DNA sequences and forms a ternary complex with serum response factor (SRF) on the serum response element (SRE) located in the promoter regions of immediate early genes such as FOS and IER2. Upon activation of the JNK or MAPK/ERK signaling cascades, ELK1 is phosphorylated and rapidly induces target-gene transcription, thereby regulating cell proliferation, differentiation, and survival.