ELL2 Polyclonal antibody

• 

  WB analysis using 12727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12727-1-AP (ELL2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12727-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12727-1-AP (ELL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12727-1-AP

  IP result of anti-ELL2 (IP:12727-1-AP, 4ug; Detection:12727-1-AP 1:300) with mouse brain tissue lysate 3440ug.

• Featured Product
• KD/KO Validated

ELL2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12727-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, ChIP, ELISA

Synonyms

ELL 2

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue, HepG2 cells, L02 cells, mouse stomach tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 6 publications below
• IF: See 1 publications below
• ChIP: See 1 publications below

Product Information

12727-1-AP targets ELL2 in WB, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3428

  Product name: Recombinant human ELL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-640 aa of BC028412

  Sequence: TNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS

• Full Name: elongation factor, RNA polymerase II, 2
• Calculated Molecular Weight: 640 aa, 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC028412
• Gene Symbol: ELL2
• Gene ID (NCBI): 22936
• RRID: AB_10644131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00472
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELL2 (Elongation Factor for RNA Polymerase II 2) is a key transcriptional elongation factor that regulates RNA polymerase II (Pol II) during mRNA synthesis (PMID: 34265249). It belongs to the ELL gene family, which includes ELL1, ELL2, and ELL3, and plays a crucial role in controlling the elongation phase of transcription (PMID: 9108030). ELL2 is an androgen-responsive gene that is expressed by prostate epithelial cells and is frequently down-regulated in prostate cancer (PMID: 29179998).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell; Inherited blood cancer predisposition through altered transcription elongation; Authors - Jiawei Zhao
mouse	WB	Cell; MicroRNA Directly Enhances Mitochondrial Translation during Muscle Differentiation.; Authors - Xiaorong Zhang ; KD Validated
mouse	WB	Mol Cell; RNA Pol II preferentially regulates ribosomal protein expression by trapping disassociated subunits; Authors - Yuanjun Li
human	ChIP	Cell Death Dis; TRIB1 regulates liver regeneration by antagonizing the NRF2-mediated antioxidant response; Authors - Xinyue Sun
mouse	WB	J Biol Chem; Cytoplasmic poly(A)-binding protein 1 (PABPC1) interacts with the RNA-binding protein hnRNPLL and thereby regulates immunoglobulin secretion in plasma cells.; Authors - Yuanzheng Peng
human	WB	FASEB J; Androgen receptor splicing variant 7 (ARv7) promotes DNA damage response in prostate cancer cells; Authors - Haoge Luo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Beth (Verified Customer) (10-05-2017)

Using LI-COR imaging system.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: RWPE1, PC-3

ELL2 Antibody Western Blot validation (1:500 dilution) in RWPE1, PC-3 (Cat no:12727-1-AP)