ELL2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ELL2 Recombinant monoclonal antibody, PBS Only (84226-4-PBS)

ELL2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84226-4-PBS

Clone No.260362A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ELL 2

• 

  WB analysis using 84226-4-RR (same clone as 84226-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84226-4-RR (ELL2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84226-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 84226-4-RR (same clone as 84226-4-PBS)

  WB result of ELL2 antibody (84226-4-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-ELL2 transfected HeLa cells. This data was developed using the same antibody clone with 84226-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

84226-4-PBS targets ELL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3428

  Product name: Recombinant human ELL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-640 aa of BC028412

  Sequence: TNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGEFDQQQAESWS

• Full Name: elongation factor, RNA polymerase II, 2
• Calculated Molecular Weight: 640 aa, 72 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC028412
• Gene Symbol: ELL2
• Gene ID (NCBI): 22936
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00472
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ELL2 (Elongation Factor for RNA Polymerase II 2) is a key transcriptional elongation factor that regulates RNA polymerase II (Pol II) during mRNA synthesis (PMID: 34265249). It belongs to the ELL gene family, which includes ELL1, ELL2, and ELL3, and plays a crucial role in controlling the elongation phase of transcription (PMID: 9108030). ELL2 is an androgen-responsive gene that is expressed by prostate epithelial cells and is frequently down-regulated in prostate cancer (PMID: 29179998). The predicted molecular weight of the ELL2 protein is 72 kDa, but due to post-translational modifications, its molecular weight is approximately 90 kDa. (PMID: 39582094, PMID: 34948391)