ELOVL3 Polyclonal antibody

• 

  WB analysis using 32474-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32474-1-AP (ELOVL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ELOVL3 Polyclonal Antibody for WB, ELISA

Cat No. 32474-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

3-keto acyl-CoA synthase ELOVL3, Cold-inducible glycoprotein of 30 kDa, EC:2.3.1.199, Elongation of very long chain fatty acids protein 3, ELOVL FA elongase 3

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse adipose tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32474-1-AP targets ELOVL3 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24318

  Product name: Recombinant human ELOVL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-126 aa of BC034344

  Sequence: YNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVI

• Full Name: elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC034344
• Gene Symbol: ELOVL3
• Gene ID (NCBI): 83401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9HB03
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELOVL3 (elongation of very long-chain fatty acids 3) is a member of the ELOVL family of enzymes that synthesize very long chain fatty acids (VLCFAs). ELOVL3 is expressed primarily in brown and white adipose tissue, skin sebaceous glands, and the liver, synthesizes C20-C24 saturated and monounsaturated fatty acids (PMID: 37847682). ELOVL3 is involved in the regulation of the progression of adipogenesis through activation of peroxisome proliferator-activated receptor (PPAR)γ in mouse adipocytic 3T3-L1 cells (PMID: 22436697, 16326704).