EMR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EMR1 Polyclonal antibody (27044-1-AP)

EMR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27044-1-AP Copied!

Publications (50)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA, Immunohistochemistry

Synonyms

ADGRE1, Adhesion G protein-coupled receptor E1, EGF like module receptor 1, EMR1, EMR1 hormone receptor, F4/80, TM7LN3

• 

  WB analysis of RAW 264.7 using 27044-1-AP

  unboiled RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 27044-1-AP (EMR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 27044-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 27044-1-AP (EMR1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 27044-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27044-1-AP (EMR1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 27044-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27044-1-AP (EMR1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 27044-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27044-1-AP (EMR1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 27044-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27044-1-AP (EMR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 27044-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27044-1-AP (EMR1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse peritoneal macrophages using 27044-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed mouse peritoneal macrophages using EMR1 antibody (27044-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EMR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: unboiled RAW 264.7 cells, HL-60 cells
• Positive IHC detected in: mouse spleen tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: mouse peritoneal macrophages

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27044-1-AP targets EMR1 in WB, IHC, IF/ICC, ELISA, Immunohistochemistry applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25883

  Product name: Recombinant human EMR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-510 aa of BC059395

  Sequence: TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK

• Full Name: egf-like module containing, mucin-like, hormone receptor-like 1
• Calculated Molecular Weight: 886 aa, 97 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC059395
• Gene Symbol: EMR1
• Gene ID (NCBI): 2015
• RRID: AB_2716814
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EMR1 (EGF-like module containing mucin-like hormone receptor 1), also known as Adhesion G protein-coupled receptor E1 (ADGRE1), is a surface receptor with seven transmembrane segments that belong to the EGF-7-transmembrane family of G protein-coupled receptors (PMID: 14647991, 7601460). EMR1 expression is restricted to eosinophilic granulocytes, where expression is overlapping with the eotaxin receptor CCR3 and the immunoglobulin-like lectin Siglec-8. Absence on other leukocytes, including basophils, implies that EMR1 is a highly specific marker for eosinophils in humans and may be used as a novel therapeutic target for eosinophilic disorders (PMID: 17823986, 24530099). F4/80, the murine homolog of EMR1, is a marker of murine macrophage. The apparent molecular weight of F4/80 is 160 kDa, which is larger than the calculated molecular weight due to post-translational modifications (PMID: 7308288; 8647179).

Publications

What published studies show

The EMR1 Polyclonal antibody (Cat# 27044-1-AP) has 50 citations spanning high-impact journals including Nature, Cell, Cell Metabolism, Nature Metabolism, Nature Communications, Cell Research, Autophagy, and Cell Death & Disease. Research fields covered include MASH/NASH, obesity, cancer (HCC, bladder, colorectal), macrophage polarization, fibrosis (renal, pulmonary, skin), inflammation, osteoarthritis, diabetes, cardiovascular disease, and pyroptosis. Applications reported include WB, IHC, and IF across mouse, human, rat, and pig species.

Automatically generated from the 50 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; RYK is a GPNMB receptor that drives MASH.; Authors - Yue Xi
		Cell; Extracellular vesicles from the lung pro-thrombotic niche drive cancer-associated thrombosis and metastasis via integrin beta 2; Authors - Serena Lucotti
		Cell Metab; UBE2M-mediated neddylation of TRIM21 regulates obesity-induced inflammation and metabolic disorders; Authors - Xinliang Lu
human	IHC	Cell Res; A phosphatidic acid-binding lncRNA SNHG9 facilitates LATS1 liquid-liquid phase separation to promote oncogenic YAP signaling.; Authors - Rui-Hua Li
mouse	WB	Nat Metab; Gpnmb secreted from liver promotes lipogenesis in white adipose tissue and aggravates obesity and insulin resistance.; Authors - Xue-Min Gong
mouse	IF	Autophagy; Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway; Authors - Meng Chen