Use Able AI chat for product recommendations

EMR1 Polyclonal antibody

EMR1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27044-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA, Immunohistochemistry

ADGRE1, Adhesion G protein-coupled receptor E1, EGF like module receptor 1, EMR1, EMR1 hormone receptor, F4/80, TM7LN3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled RAW 264.7 cells, HL-60 cells
Positive IHC detected inmouse spleen tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inmouse peritoneal macrophages

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27044-1-AP targets EMR1 in WB, IHC, IF/ICC, ELISA, Immunohistochemistry applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25883

Product name: Recombinant human EMR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 430-510 aa of BC059395

Sequence: TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK

Predict reactive species
Full Name egf-like module containing, mucin-like, hormone receptor-like 1
Calculated Molecular Weight886 aa, 97 kDa
Observed Molecular Weight 160 kDa
GenBank Accession NumberBC059395
Gene Symbol EMR1
Gene ID (NCBI) 2015
RRIDAB_2716814
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14246
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EMR1 (EGF-like module containing mucin-like hormone receptor 1), also known as Adhesion G protein-coupled receptor E1 (ADGRE1), is a surface receptor with seven transmembrane segments that belong to the EGF-7-transmembrane family of G protein-coupled receptors (PMID: 14647991, 7601460). EMR1 expression is restricted to eosinophilic granulocytes, where expression is overlapping with the eotaxin receptor CCR3 and the immunoglobulin-like lectin Siglec-8. Absence on other leukocytes, including basophils, implies that EMR1 is a highly specific marker for eosinophils in humans and may be used as a novel therapeutic target for eosinophilic disorders (PMID: 17823986, 24530099). F4/80, the murine homolog of EMR1, is a marker of murine macrophage. The apparent molecular weight of F4/80 is 160 kDa, which is larger than the calculated molecular weight due to post-translational modifications (PMID: 7308288; 8647179).

Protocols

Product Specific Protocols
IF protocol for EMR1 antibody 27044-1-APDownload protocol
IHC protocol for EMR1 antibody 27044-1-APDownload protocol
WB protocol for EMR1 antibody 27044-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIHC

Cell Res

A phosphatidic acid-binding lncRNA SNHG9 facilitates LATS1 liquid-liquid phase separation to promote oncogenic YAP signaling.

Authors - Rui-Hua Li
mouseIHC

Acta Pharm Sin B

A non-human primate derived anti-P-selectin glycoprotein ligand-1 antibody curtails acute pancreatitis by alleviating the inflammatory responses

Authors - Yuhan Li
mouseIF

Autophagy

Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway

Authors - Meng Chen
humanIHC

Theranostics

SPTBN1 inhibits inflammatory responses and hepatocarcinogenesis via the stabilization of SOCS1 and downregulation of p65 in hepatocellular carcinoma.

Authors - Ling Lin
humanIF

Cancer Lett

MicroRNA-15b in extracellular vesicles from arsenite-treated macrophages promotes the progression of hepatocellular carcinomas by blocking the LATS1-mediated Hippo pathway.

Authors - Junjie Li
humanIHC

Front Immunol

PMID: 31249571

Authors - Le Liu
Loading...
||
New chat

Able

正在加载,请稍候...