ENGASE Polyclonal antibody

• 

  IHC staining of mouse spleen using 31784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 31784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 31784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 31784-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 31784-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using ENGASE antibody (31784-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

ENGASE Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 31784-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

EC:3.2.1.96, Cytosolic endo-beta-N-acetylglucosaminidase

---

Tested Applications

• Positive IHC detected in: mouse spleen tissue, mouse thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31784-1-AP targets ENGASE in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34633

  Product name: Recombinant human ENGASE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_001042573

  Sequence: IKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGR

• Full Name: endo-beta-N-acetylglucosaminidase
• Calculated Molecular Weight: 84 kDa
• GenBank Accession Number: NM_001042573
• Gene Symbol: ENGASE
• Gene ID (NCBI): 64772
• RRID: AB_3670113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NFI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endo-β-N-acetylglucosaminidase (ENGASE) is an enzyme that belongs to glycoside hydrolase (GH) families 18 and 85, and is widely distributed in bacteria, fungi, and higher-order species. ENGASE hydrolyzes the β1-4 linkage of the N, N-diacetylchitobiose (GlcNAcβ1-4GlcNAc) region of the N-linked glycans present on glycoproteins (PMID: 36435009). ENGASE is widely expressed, with higher expression in thymus and spleen (Refer to Uniprot).