ENPP7 Polyclonal antibody

• 

  WB analysis using 32226-1-AP

  Mouse testis tissue lysate was subjected to SDS PAGE followed by western blot with 32226-1-AP (ENPP7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ENPP7 Polyclonal Antibody for WB, ELISA

Cat No. 32226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Alkaline sphingomyelin phosphodiesterase, Alk-SMase, EC:3.1.4.12, Ectonucleotide pyrophosphatase/phosphodiesterase family member 7, E-NPP 7

---

Tested Applications

• Positive WB detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32226-1-AP targets ENPP7 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36493

  Product name: Recombinant human ENPP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-400 aa of NM_178543.4

  Sequence: QGVAVTRSRKEGIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPE

• Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 7
• Calculated Molecular Weight: 51 kDa，458aa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: NM_178543.4
• Gene Symbol: ENPP7
• Gene ID (NCBI): 339221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6UWV6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 (ENPP7) stands out as an alkaline sphingomyelinase that functions in the intestine to cleave sphingomyelin (SM) into ceramide and phosphocholine in a phospholipase C (PLC) -like manner and has been associated with hepatobiliary diseases. Reduced ENPP7 activity is detected in colorectal cancer and in familial adenomatous polyposis, suggesting a link between decreased SM metabolism and colon tumorigenesis (PMID: 22177013; 28292932).