ENTPD6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ENTPD6 Polyclonal antibody (11626-1-AP)

ENTPD6 Polyclonal Antibody for IHC, ELISA

Cat No. 11626-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

CD39 antigen-like 2, CD39L2, EC:3.6.1.6, ENTPD 6, NTPDase 6

• 

  IHC staining of human prostate cancer using 11626-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11626-1-AP (ENTPD6 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11626-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11626-1-AP (ENTPD6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ENTPD6 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11626-1-AP targets ENTPD6 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2148

  Product name: Recombinant human ENTPD6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-483 aa of BC025980

  Sequence: ATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITINFLTGSLKTPGGSSVGMLDLGGGSTQIAFLPRVEGTLQASPPGYLTALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS

• Full Name: ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
• Calculated Molecular Weight: 483 aa, 53 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC025980
• Gene Symbol: ENTPD6
• Gene ID (NCBI): 955
• RRID: AB_2100196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75354
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ENTPD6 Polyclonal antibody (Cat# 11626-1-AP) has 1 citation. It appears in World J Clin Oncol (2025), a study titled "Systematic pan-cancer analysis reveals the prognostic and immunological roles of ectonucleoside triphosphate diphosphohydrolase 6." The research field is oncology, specifically pan-cancer prognosis and tumor immunology. The antibody was used for IHC in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	World J Clin Oncol; Systematic pan-cancer analysis reveals the prognostic and immunological roles of ectonucleoside triphosphate diphosphohydrolase 6.; Authors - Gang Wang