EOMES/TBR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EOMES/TBR2 Polyclonal antibody (33826-1-AP)

• 

  WB analysis using 33826-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33826-1-AP (EOMES antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of NK-92 using 33826-1-AP

  1x10^6 NK-92 cells were intracellularly stained with 0.5 ug EOMES/TBR2 Polyclonal antibody (33826-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.5 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

EOMES/TBR2 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 33826-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

EOMES, TBR2, Eomesodermin homolog, T box brain protein 2, T brain 2

---

Tested Applications

• Positive WB detected in: NK-92 cells
• Positive FC (Intra) detected in: NK-92 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.5 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33826-1-AP targets EOMES/TBR2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39989

  Product name: Recombinant human EOMES protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 460-613 aa of NM_005442.3

  Sequence: SSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEE

• Full Name: eomesodermin homolog (Xenopus laevis)
• Calculated Molecular Weight: 686aa, 73 kDa
• Observed Molecular Weight: 70-72 kDa
• GenBank Accession Number: NM_005442.3
• Gene Symbol: EOMES
• Gene ID (NCBI): 8320
• RRID: AB_3743083
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EOMES/TRB2 (also named Eomesodermin/Tbr2) encodes T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller subventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880).