EP300 Polyclonal antibody

EP300 Polyclonal Antibody for WB, ELISA
Cat No. 27565-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

E1A associated protein p300, E1A binding protein p300, EP300, Histone acetyltransferase p300, KAT3B, p300, p300 HAT

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

27565-1-AP targets EP300 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26765

Product name: Recombinant human EP300 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 946-1045 aa of NM_001429

Sequence: MSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSK

Predict reactive species
Full Name E1A binding protein p300
Calculated Molecular Weight 264 kDa
GenBank Accession NumberNM_001429
Gene Symbol EP300
Gene ID (NCBI) 2033
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ09472
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.
Loading...
||
New chat Able
正在加载,请稍候...