EP400 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EP400 Polyclonal antibody, PBS Only (13858-1-PBS)

• 

  IP experiment of HEK-293 using 13858-1-AP (same clone as 13858-1-PBS)

  IP result of anti-EP400 (IP:13858-1-AP, 4ug; Detection:13858-1-AP 1:500) with HEK-293 cells lysate 1440 ug. This data was developed using the same antibody clone with 13858-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13858-1-AP (same clone as 13858-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13858-1-AP (EP400 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13858-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13858-1-AP (same clone as 13858-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EP400 antibody (13858-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 13858-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 13858-1-AP (same clone as 13858-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using EP400 antibody (13858-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 13858-1-PBS in a different storage buffer formulation.

EP400 Polyclonal Antibody for IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13858-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CAGH32, E1A-binding protein p400, EC:3.6.4.-, EP 400, hDomino

---

Product Information

13858-1-PBS targets EP400 in IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4832

  Product name: Recombinant human EP400 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC037208

  Sequence: MHHGTGPQNVQHQLQRSRACPGSEGEEQPAHPNPPPSPAAPFAPSASPSAPQSPSYQIQQLMNRSPATGQNVNITLQSVGPVVGGNQQITLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGV

• Full Name: E1A binding protein p400
• Calculated Molecular Weight: 3160 aa, 344 kDa
• Observed Molecular Weight: 344 kDa
• GenBank Accession Number: BC037208
• Gene Symbol: EP400
• Gene ID (NCBI): 57634
• RRID: AB_3741847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96L91
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

E1A binding protein p400 (EP400) is a SWR1-class ATP-dependent chromatin remodeling protein originally identified as an interacting partner for the adenovirus E1A protein required for viral replication and cellular transformation. EP400 plays a crucial role in promoting double-strand break (DSB) repair through homologous recombination (PMID: 26669263, 37922899). Depletion of Ep400 in oocytes led to accumulated DSBs, causing abnormal aggregation and dysfunction of cytoplasmic organelles, resulting in impaired oocyte development and declined oocyte quality (PMID: 38493496).