EPB41L4B Recombinant monoclonal antibody, PBS Only (Capture)

EPB41L4B Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84732-2-PBS
Clone No.242186G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

242186G4, Band 4.1 like protein 4B, CG1, EHM2, FERM containing protein CG1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84732-2-PBS targets EPB41L4B as part of a matched antibody pair:

MP01525-1: 84732-2-PBS capture and 84732-1-PBS detection (validated in Cytometric bead array)

MP01525-2: 84732-2-PBS capture and 84732-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag36353

Product name: Recombinant human EPB41L4B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 550-700 aa of NM_00138562

Sequence: TPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTS

Predict reactive species
Full Name erythrocyte membrane protein band 4.1 like 4B
Calculated Molecular Weight99kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberNM_00138562
Gene Symbol EPB41L4B
Gene ID (NCBI) 54566
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H329
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The 4.1 proteins, encoded by the EPB41 (erythrocyte protein band 4.1) genes, are components of the cortical cytoskeleton underlying the cell membrane. The family of 4.1 proteins consists of the eponymous 4.1R protein first identified in erythrocytes (gene: EPB41), 4.1N (EPB41L1), 4.1G (EPB41L2), 4.1B (EPB41L3) as well as the less closely related members NBL4 (EPB41L4A), EHM2 (EPB41L4B) and EPB41L5 (EPB41L5). EHM2 is conspicuous in tumor cells with high migratory potential, such as metastatic melanoma and fibrosarcoma cells. In prostate cancer, EHM2 has been reported to be overexpressed and to diminish adhesion of prostate cancer cells to collagen. (PMID: 20860828)

Loading...
||
New chat Able
正在加载,请稍候...