EPB41L5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EPB41L5 Polyclonal antibody (29180-1-AP)

• 

  WB analysis using 29180-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29180-1-AP (EPB41L5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

EPB41L5 Polyclonal Antibody for WB, ELISA

Cat No. 29180-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA1548, Band 4.1 like protein 5

---

Tested Applications

• Positive WB detected in: LNCaP cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29180-1-AP targets EPB41L5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30300

  Product name: Recombinant human EPB41L5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 349-445 aa of BC032822

  Sequence: GKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRK

• Full Name: erythrocyte membrane protein band 4.1 like 5
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC032822
• Gene Symbol: EPB41L5
• Gene ID (NCBI): 57669
• RRID: AB_3669676
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCM4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPB41L5, a member of the NBL4 subgroup of the band 4.1 superfamily, contains a FERM domain and plays an important role in regulating the connection between plasma membrane proteins and the cytoskeleton underneath the plasma membrane (PMID: 30082297). EPB41L5 is a mesenchymal-specific protein induced during EMT (epithelial-mesenchymal transition) that promotes the disruption of cell-cell adhesion kinetics (PMID: 34784520). EPB41L5 exists as four alternatively spliced isoforms encoded by a gene located on human chromosome 2q14.2.