EPCAM/CD326 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• EPCAM/CD326 Recombinant monoclonal antibody (84073-11-RR)

EPCAM/CD326 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 84073-11-RR

Clone No.250626D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

EPCAM, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1, CO 17A

• 

  IHC staining of human colon using 84073-11-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84073-11-RR (EPCAM/CD326 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 84073-11-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84073-11-RR (EPCAM/CD326 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 84073-11-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84073-11-RR (EPCAM/CD326 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 84073-11-RR

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 84073-11-RR (EPCAM/CD326 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 84073-11-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using EPCAM/CD326 antibody (84073-11-RR, Clone: 250626D3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 84073-11-RR

  Biolayer interferometry (BLI) kinetic assays of 84073-11-RR against Human EPCAM/CD326 were performed. The affinity constant is 0.619 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human colon tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84073-11-RR targets EPCAM/CD326 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1370

  Product name: Recombinant Human EpCAM/CD326 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-265 aa of NM_002354.3

  Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Full Name: epithelial cell adhesion molecule
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_002354.3
• Gene Symbol: EPCAM
• Gene ID (NCBI): 4072
• RRID: AB_3743521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16422
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)