Anti-Human EPCAM/CD326 Rabbit scFv Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Anti-Human EPCAM/CD326 Rabbit scFv Antibody, PBS Only (SF98303-5-PBS)

EPCAM/CD326 Recombinant Antibody for FC, Indirect ELISA

Cat No. SF98303-5-PBS

Clone No.250626C6

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC, Indirect ELISA

Synonyms

EPCAM, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1, CO 17A

• 

  FC experiment of HT-29 using SF98303-5-RR (same clone as SF98303-5-PBS)

  1x10^6 HT-29 cells (left) or HeLa cells (right) were surface stained with 0.25 ug EPCAM/CD326 Recombinant Antibody (SF98303-5-RR, Clone: 250626C6) (red) or 0.25 ug Rabbit scFv Isotype Control (SF98136-1-RR, Clone: 240953C9) (blue), and PE Anti-6*His, His-Tag Rabbit RecAb (PE-FcA98450, Clone: 251107A1). Cells were not fixed. This data was developed using the same antibody clone with SF98303-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

SF98303-5-PBS targets EPCAM/CD326 in FC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg1370

  Product name: Recombinant Human EpCAM/CD326 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-265 aa of NM_002354.3

  Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Full Name: epithelial cell adhesion molecule
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_002354.3
• Gene Symbol: EPCAM
• Gene ID (NCBI): 4072
• RRID: AB_3750158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)