EPHA6 Polyclonal antibody

• 

  IHC staining of human brain using 24452-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24452-1-AP (EPHA6 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 24452-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24452-1-AP (EPHA6 Antibody) at dilution of 1:200 (under 40x lens).

EPHA6 Polyclonal Antibody for IHC, ELISA

Cat No. 24452-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

EHK 2, EHK2, EPA6, EPH homology kinase 2, EPH receptor A6, EPHA6, Ephrin type A receptor 6, PRO57066

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24452-1-AP targets EPHA6 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19871

  Product name: Recombinant human EPHA6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 896-1036 aa of BC156733

  Sequence: PAPMGCPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNPSALHTLVEDILVMPESPGEVPEYPLFVTVGDWLDSIKMGQYKNNFVAAGFTTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQTLRLHMMHIQEKGFHV

• Full Name: EPH receptor A6
• Calculated Molecular Weight: 1035 aa, 116 kDa
• GenBank Accession Number: BC156733
• Gene Symbol: EPHA6
• Gene ID (NCBI): 285220
• RRID: AB_2879555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UF33
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.