EPHB3 Polyclonal antibody

EPHB3 Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 21382-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

EK2, EPH like kinase 2, EPH receptor B3, Ephrin type B receptor 3, ETK2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21382-1-AP targets EPHB3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16016

Product name: Recombinant human EPHB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 261-390 aa of BC052968

Sequence: EWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACS

Predict reactive species
Full Name EPH receptor B3
Calculated Molecular Weight 998 aa, 110 kDa
GenBank Accession NumberBC052968
Gene Symbol EPHB3
Gene ID (NCBI) 2049
RRIDAB_3669366
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP54753
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPHB3 is a member of the Eph receptor tyrosine kinase family. The Eph receptors comprise a large family of closely related transmembrane tyrosine kinases that actively signal when bound to their ephrin ligands. The Eph receptors are characterized by an extracellular region with a unique cysteine-rich motif extending over its amino-terminal half, followed by two fibronectin type III motifs (PMID: 9530499). They are divided into two sub-groups (EphA and EphB) based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands (PMID: 11114742). The EPHB3 protein has multiple functions in the nervous system, including regulating neural networks, participating in epileptic activity, and playing a role in repair after spinal cord injury.

Protocols

Product Specific Protocols
IHC protocol for EPHB3 antibody 21382-1-APDownload protocol
IF protocol for EPHB3 antibody 21382-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...