EPN2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84366-5-RR (same clone as 84366-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84366-5-RR (EPN2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84366-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 84366-5-RR (same clone as 84366-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 84366-5-RR (EPN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84366-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 84366-5-RR (same clone as 84366-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 84366-5-RR (EPN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84366-5-PBS in a different storage buffer formulation.

EPN2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84366-5-PBS

Clone No.241634F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Epsin-2, epsin 2, EPS-15-interacting protein 2, EPS 15 interacting protein 2, EHB21

---

Product Information

84366-5-PBS targets EPN2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35194

  Product name: Recombinant human EPN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 252-448 aa of BC093972

  Sequence: LEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSA

• Full Name: epsin 2
• Calculated Molecular Weight: 584 aa, 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC093972
• Gene Symbol: EPN2
• Gene ID (NCBI): 22905
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95208
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPN2 (EPS 15 interacting protein 2) is a protein that interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. EPN2 is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery.